- KIF2B Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86002
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated
- KIF2B
- Rabbit
- PBS (pH 7.2) and 40% Glycerol
- Human
- 0.1 ml (also 25ul)
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: ALAPSSAIRD QRTATKWVAM IPQKNQTASG DSLDVRVPSK PCLMKQKKSP CLWEIQKLQE QREKRRRLQQ EIRARRALDV NTRN
- kinesin family member 2B
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cell Biology, Cell Cycle and Replication, Cytoskeleton Markers, Immunology, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ALAPSSAIRDQRTATKWVAMIPQKNQTASGDSLDVRVPSKPCLMKQKKSPCLWEIQKLQEQREKRRRLQQEIRARRALDVNTRN
Specifications/Features
Available conjugates: Unconjugated