Anti-Alpha B Crystallin antibody [1B6.1-3G4] ab13496 from Abcam

Product Specs
ItemAnti-Alpha B Crystallin antibody [1B6.1-3G4]
CompanyAbcam
Price Supplier Page View Company Product Page
Catalog Numberab13496
Domain/Region/Terminus1-3
Antibody TypePrimary
Quantity100 UG
ApplicationsFlow Cytometry, Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections), Immunohistochemistry (Frozen sections), Western blot
HostMouse, Nude mouse
ClonalityMonoclonal
Clone1B6.1-3G4
IsotypeIgG1
Conjugate/TagUnconjugated
FormatThis antibody is affinity purified
Concentration1 mg/ml
Gene NameCRYAB
ReactivityHuman
TargetAlpha B Crystallin

Add to Compare List

Abcam

Discovery Drive

Cambridge Biomedical Campus

Cambridge CB2 0AX

United Kingdom

Phone: +44 (0) 1223 696000 (option 1)
+44 (0) 1223 696000 (option 2)
+44 (0) 1223 771600

Company Profile

Website: http://www.abcam.com

(1) A novel αB-crystallin R123W variant drives hypertrophic cardiomyopathy by promoting maladaptive calcium-dependent signal transductionFrontiers in Cardiovascular MedicineJune 26, 2023Chun Chou, Gregory L. Martin, Gayani Perera, Junya Awata, Amy Larson, Robert Blanton, Michael T. Chinanalyzed by immunoblotting. The following primary antibodies were used for immunoblot assay: anti-Cryab (ab13496, Abcam) and anti-Calcineurin (55,6350, BD Biosciences). The following secondary antibodies were used:

(2) Alpinumisoflavone ameliorates choroidal neovascularisation and fibrosis in age-related macular degeneration in in vitro and in vivo modelsScientific ReportsAugust 22, 2022Eunhye Yu, Yunjeong Song, Sun Mi Gu, Yang Hee Jo, Sang Won Yeon, Kyu Jin Han, Mi Kyeong Lee, Jung Kee Min, Jaesuk Yunovernight at 4 °C with alpha-SMA (Abcam, ab5694, 1:1000), VEGFA (Abcam, ab46154, 1:1000) CRYAB (Abcam, ab13496, 1:2500), phospho-CRYAB (Ser59; Invitrogen, PA1-012, 1:2500), and GAPDH (Cell Signaling Technology,

(3) Cluster analyses of the TCGA and a TMA dataset using the coexpression of HSP27 and CRYAB improves alignment with clinical-pathological parameters of breast cancer and suggests different epichaperome influences for each sHSPCell Stress and ChaperonesMarch 2, 2022Philip R. Quinlan et al.Cancer Research Technology, mouse monoclonal ERD5. C: Anti-CRYAB, Abcam mouse monoclonal 1b6.1-3G4 (ab13496). D: Anti-HSP27, Abcam rabbit polyclonal (Ab47436). Bar = 100 µm.

(4) Associations of Apoptotic and Anti-Apoptotic Factors with Beef Quality, Histochemical Characteristics, and Palatability of Hanwoo Longissimus thoracis MuscleAnimals (Basel)February 14, 2022Boin Lee, Jae-Yeong Kim, Young-Min ChoiFor Western blot analysis, the following primary antibodies were used: αβ-crystallin (1:10,000 dilution; ab13496, Abcam Ltd., Cambridge, UK), HSP20 (1:1000 dilution; ab13491, Abcam Ltd.), and HSP27 (1:3000 dilution;

(5) Developmental Origins of Human Cortical Oligodendrocytes and AstrocytesNeuroscience bulletinJanuary 1, 2022Yang L, Li Z, Liu G, Li X, Yang Z.mouse brain sections), mouse anti PAX6 (1:500, BD Biosciences, 561664), mouse anti CRYAB (1:300, Abcam, ab13496); goat anti SOX10 (1:500, R&D System, AF2864), chicken anti GFAP (1:1,500, Abcam, ab4674), rabbit anti

(6) Clinical Course, Myopathology and Challenge of Therapeutic Intervention in Pediatric Patients with Autoimmune-Mediated Necrotizing MyopathyChildren (Basel)August 24, 2021Adela Della Marina et al.and stored at 4 °C. Immunohistochemistry was conducted using antibodies against αB-crystallin (Abcam, ab13496, 1:2.500, mouse, clone 1B6.1-3G4), HSP70 (Abcam, ab6535, 1:100, mouse, clone BRM-22), LC3 (Nanotools

(7) Long Circulation of PEG-TRAIL Improves Anti-Hepatic Fibrosis Effect of TRAIL Via Targeting Activated Hepatic Stellate CellsFrontiers in MaterialsJune 17, 2021Bingyun Lu, Lijun Peng, Shenggen Luo, Jing’e Zhou, Nan Xu, Chunxiu Dong, Zhiqiang Yan, Huiyi Li, Qinghua Lisc-59727, Santa Cruz) or PAI-1 (plasminogen activator inhibitor type-1; sc-5297, Santa Cruz), β-crystallin (ab13496, Abcam), α-SMA (α-smooth muscle actin; ab5831, Abcam), collagen I (ab34710, Abcam), and collagen III (ab7778,

(8) Qki activates Srebp2-mediated cholesterol biosynthesis for maintenance of eye lens transparencyNature communicationsMay 21, 2021Shin S, Zhou H, He C, Wei Y, Wang Y, Shingu T, Zeng A, Wang S, Zhou X, Li H, et al.primary antibodies overnight at 4 °C: anti-Pax6 (Abcam, ab5790, 1:200), anti–αB-crystallin (Abcam, ab13496, 1:500), anti–Qki-5 (immunizing rabbit with a short synthetic peptide [CGAVATKVRRHDMRVHPYQRIVTADRAATGN],

(9) Inflammatory features in sporadic late-onset nemaline myopathy are independent from monoclonal gammopathyBrain pathology (Zurich, Switzerland)May 1, 2021Tanboon J, Uruha A, Arahata Y, Dittmayer C, Schweizer L, Goebel HH, Nishino I, Stenzel W.Abcam), BAG3 (ab47124, Abcam), LC3 (0260‐100/LC3‐2G6, nanoTools Art), and alpha‐B‐crystallin (CRYAB) (ab13496, Abcam) were additionally performed in nine cases. JT, AU, IN, and WS performed the pathological evaluation. We

(10) Peripherally misfolded proteins exacerbate ischemic stroke-induced neuroinflammation and brain injuryJournal of neuroinflammationJanuary 20, 2021Liu Y, Subedi K, Baride A, Romanova S, Callegari E, Huber CC, Wang X, Wang H.LKF6437), anti-NeuN antibody (1:1000, Millipore, #ABN78, Lot 1979271), anti-CryAB antibody (1:100, Abcam, #ab13496), anti-TNFα antibody (1:100, Abcam, #ab1793, Lot GR3261538-1), anti-Myc antibody (Cell Signaling Technology,

(11) mTOR signaling regulates the morphology and migration of outer radial glia in developing human cortexeLifeSeptember 2, 2020Andrews MG, Subramanian L, Kriegstein AR.monoclonal),Abcam,RRID:AB_443110; Cat# ab14955,(1:500) Antibody,anti-Cryab (Mouse monoclonal),Abcam,RRID:AB_300400; Cat# ab13496,(1:500) Antibody,anti-Hopx (Rabbit polyclonal),Proteintech,RRID:AB_10693525; Cat# 11419–1-AP,(1:500) Antibody,anti-pS6

(12) Changes in the Oligodendrocyte Progenitor Cell Proteome with AgeingMolecular & cellular proteomics : MCPAugust 1, 2020de la Fuente AG, Queiroz RML, Ghosh T, McMurran CE, Cubillos JF, Bergles DE, Fitzgerald DC, Jones CA, Lilley KS, Glover CP, et al.(R and D systems, AF2439) 1:1000; Rabbit PLP (Abcam, Cambridge, UK, ab28486) 1:500; Mouse CRYAB (Abcam, ab13496) 1:500; Rabbit proteasome 19S (Abcam, ab137109), alpha tubulin (1:1000) (Millipore, T9026). Following

(13) PNU282987 inhibits amyloid‑β aggregation by upregulating astrocytic endogenous αB‑crystallin and HSP‑70 via regulation of the α7AChR, PI3K/Akt/HSF‑1 signaling axisMolecular medicine reportsJuly 1, 2020Ren Z, Dong Z, Xie P, Lv J, Hu Y, Guan Z, Zhang C, Yu W.BioLegend, Inc.), rabbit polyclonal anti‑HSP‑70 (cat. no. AB9920; Sigma‑Aldrich; Merck KGaA), anti‑Cryab (cat. no. ab13496; Abcam), anti‑ β ‑actin (cat. no. sc‑47778; Santa Cruz Technology, Inc.), rabbit monoclonal anti‑phospho‑(cat.

(14) Associations of Heat-Shock Protein Expression with Meat Quality and Sensory Quality Characteristics in Highly Marbled Longissimus Thoracis Muscle from Hanwoo Steers Categorized by Warner–Bratzler Shear Force ValueFoodsDecember 4, 2019Eunmi Oh, Boin Lee, Young Min Choi(TBS)/Tween. For Western blot analysis, the primary antibodies used were αβ-crystallin (1:10,000 dilution; ab13496, Abcam Ltd., Cambridge, UK), HSP20 (1:400 dilution; sc-51955, Santa Cruz Biotechnology Inc., Santa Cruz,

(15) Radiation-Stimulated Translocation of CD166 and CRYAB to the Endothelial Surface Provides Potential Vascular Targets on Irradiated Brain Arteriovenous MalformationsInternational journal of molecular sciencesNovember 20, 2019McRobb LS, McKay MJ, Gauden AJ, Lee VS, Subramanian S, Thomas SG, Wiedmann MK, Moutrie V, Grace M, Zhao Z, et al.permeabilization to enable assessment of surface localization [5,14]. Antibodies against CRYAB (mouse monoclonal, ab13496, Abcam, Cambridge, MA, USA), and CD166 (goat polyclonal, PA5-47083, Thermo Fisher Scientific) were used

(16) Highly Dynamic Changes in the Activity and Regulation of Macroautophagy in Hearts Subjected to Increased Proteotoxic StressFrontiers in PhysiologyJune 26, 2019Bo Pan, Megan T. Lewno, Penglong Wu, Xuejun Wang(#G8795, Sigma-Aldrich; 1:1,000), LC3B (#2775, Cell Signaling; 1:1,000), Anti-Alpha B Crystallin (#ab13496, Abcam; 1:1,000), mTOR (#2983, Cell Signaling; 1:1,000), Phospho-mTOR (Ser2481) (#2974, Cell Signaling;

(17) Multimodal Single-Cell Analysis Reveals Physiological Maturation in the Developing Human NeocortexNeuronApril 3, 2019Mayer S, Chen J, Velmeshev D, Mayer A, Eze UC, Bhaduri A, Cunha CE, Jung D, Arjun A, Li E, et al.AB_2572882 Streptavidin Dylight 549,Vector Labs,SA-5549; RRID: AB_2336408 Mouse anti Cryab,Abcam,ab13496; RRID: AB_300400 Rabbit anti PPP1R17,Sigma,HPA 047819; RRID: AB_2680166 ,, Chemicals,Chemicals,Chemicals ,, NMDA

(18) Chemically modified liposomes carrying TRAIL target activated hepatic stellate cells and ameliorate hepatic fibrosis in vitro and in vivoJournal of cellular and molecular medicineMarch 1, 2019Li Q, Ding Y, Guo X, Luo S, Zhuang H, Zhou J, Xu N, Yan Z.DR5 (ab8416; Abcam), uPA (sc‐59727; Santa Cruz, USA), PAI‐1 (sc‐5297; Santa Cruz, USA), β‐crystallin (ab13496; Abcam), collagen I (ab34710; Abcam), collagen III (ab7778; Abcam) or glyceraldehyde‐3‐phosphate dehydrogenase

(19) Preclinical stress originates in the rat optic nerve head during development of autoimmune optic neuritisGliaMarch 1, 2019Stojic A, Bojcevski J, Williams SK, Bas-Orth C, Nessler S, Linington C, Diem R, Fairless R.in TBS, and incubated in anti‐αB‐crystallin primary antibody (1:1000; clone 1B6.1‐3G4; Abcam, Cat# ab13496, RRID: AB_300400), whereas for glyceraldehyde 3‐phosphate dehydrogenase (GAPDH) detection, blocking

(20) Mutations in GFAP Disrupt the Distribution and Function of Organelles in Human AstrocytesCell reportsOctober 23, 2018Jones JR, Kong L, Hanna MG 4th, Hoffman B, Krencik R, Bradley R, Hagemann T, Choi J, Doers M, Dubovis M, et al.RESOURCE,SOURCE,IDENTIFIER Antibodies,Antibodies,Antibodies Mouse anti-αB Crystallin,Abcam,"Cat# ab13496, RRID: AB_300400" Rabbit anti-Connexin43,Abcam,"Cat# ab11370, RRID: AB_297976" Rabbit anti-ERp57,Proteintech,"Cat#

Be the First to Write a Review!

Cell Stress and Chaperones

Anti-Alpha B Crystallin antibody [1B6.1-3G4] from Abcam

Abcam

Citations (47)

Reviews

Anti-Alpha B Crystallin antibody [1B6.1-3G4] from Abcam

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map