- Recombinant Citrobacter koseri UPF0102 protein CKO_04542 (CKO_04542)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1142309
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 12,684 Da
- E Coli or Yeast
- 1-110
- UPF0102 protein CKO_04542 (CKO_04542)
Sequence
MWEAAARRWLESKGLRFIAANVRERGGEIDLIMRDGKTTVFVEVRYRRSAQFGGAAASVTWSKQHKLLQTARLWLARHNGSFDTVDCRFDVLAFTGNDVEWFKDAFNDRS