- Recombinant Ricinus communis CASP-like protein RCOM_1446020 (RCOM_1446020)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1002469
- CASP-like protein RCOM_1446020 (RCOM_1446020)
- 1-201
- E Coli or Yeast
- 21,941 Da
- Recombinant Protein
- >90%
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- 1 mg (E Coli Derived)
Sequence
MITSIATTTAGAFEVKSLGFIPYPSQPKRIFFMAQVIFRILAIAFAVASISAMVTSDQNVIVFGMDTAARYSYSSAFRFLVGANAVVCGFSVLSLIFVCLMSRRSEAILEKNYYLFLHDMVMMVMMVSGCSAATAIGYVGRYGEKEITWTAVCDFVGKFCNQALVSIVLAYLALFCYVALTTLAAHKLNHSSSTAAIRQNE