- PPP4R1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-87241
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- 0.1 ml (also 25ul)
- Rabbit
- PBS (pH 7.2) and 40% Glycerol
- MEG1, PP4(Rmeg), PP4R1
- This antibody was developed against Recombinant Protein corresponding to amino acids: LDAHEETISI EKRSDLQDEL DINELPNCKI NQEDSVPLIS DAVENMDSTL HYIHSDSDLS NNSSFSPDEE RRTKVQ
- Human
- PPP4R1
- Unconjugated
- protein phosphatase 4 regulatory subunit 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Protein Phosphatase
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
LDAHEETISIEKRSDLQDELDINELPNCKINQEDSVPLISDAVENMDSTLHYIHSDSDLSNNSSFSPDEERRTKVQ
Specifications/Features
Available conjugates: Unconjugated