- LEUTX Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90890
- 0.1 ml (also 25ul)
- Human
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: AKWKRQQRQQ MQTRPSLGPA NQTTSVKKEE TPSAITTANI RPVSPGISDA NDHDLREPSG IKNPGGASAS ARVSSW
- PBS (pH 7.2) and 40% Glycerol
- LEUTX
- Unconjugated
- leucine twenty homeobox
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
AKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANIRPVSPGISDANDHDLREPSGIKNPGGASASARVSSW
Specifications/Features
Available conjugates: Unconjugated