- SLC25A31 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89074
- 0.1 ml (also 25ul)
- Unconjugated
- SLC25A31
- AAC4, ANT 4, ANT4, SFEC35kDa
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: FARTRLGVDI GKGPEERQFK GLGDCIMKIA KSDGIAGLYQ GFGVSVQGII VYRA
- solute carrier family 25 member 31
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
FARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYRA
Specifications/Features
Available conjugates: Unconjugated