- PNKD Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88347
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: GATANKASHN RTRALQSHSS PEGKEEPEPL SPELEYIPRK RGKNPMKA
- 0.1 ml (also 25ul)
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated
- BRP17, DYT8, FKSG19, FPD1, KIPP1184, MR-1, MR-1S, MR1, PDC, PKND1, PNKD1, R1, TAHCCP2
- Rabbit
- Human, Mouse
- Unconjugated
- PNKD
- PNKD metallo-beta-lactamase domain containing
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cancer, Cardiovascular Biology, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
GATANKASHNRTRALQSHSSPEGKEEPEPLSPELEYIPRKRGKNPMKA
Specifications/Features
Available conjugates: Unconjugated