- Glut3 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89762
- This antibody was developed against Recombinant Protein corresponding to amino acids: KVPETRGRTF EDITRAFEGQ AHGADRSGKD GVMEMNSIEP AKETTT
- Glut3
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human
- Unconjugated
- Rabbit
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- GLUT3
- solute carrier family 2 member 3
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- 54 kDa
- Primary Antibodies
- Alzheimers Research, Cancer, Cell Biology, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTT
Specifications/Features
Available conjugates: Unconjugated