- XCR1/CCXCR1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88143
- Human
- Rabbit
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: MESSGNPEST TFFYYDLQSQ PCENQAWVFA TLA
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% glycerol
- XCR1/CCXCR1
- IL8RBA, CKR-1, IL8RA, GPR5, CDw128a, C-C-CKR-1, C-C, CD128, CCXCR1, CD181, IL8R1, CMKAR1
- C-X-C motif chemokine receptor 1, X-C motif chemokine receptor 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Chemokines and Cytokines, GPCR
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MESSGNPESTTFFYYDLQSQPCENQAWVFATLA
Specifications/Features
Available conjugates: Unconjugated