- IL-22BP/IL22 RA2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85455
- Human, Mouse
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: PNLPYRYQKE KNVSIEDYYE LLYRVFIINN SLEKEQKVYE GAHRAVEIEA LTPHSSYCVV AEIYQPMLDR RSQRSEERCV EIP
- Unconjugated
- CRF2-10, CRF2-S1, CRF2X, IL-22BP, IL-22R-alpha-2, IL-22RA2, ZCYTOR16
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- IL-22BP/IL22 RA2
- interleukin 22 receptor subunit alpha 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Cytokine Research, Immunology, Signal Transduction
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
Specifications/Features
Available conjugates: Unconjugated