- PPP2R3A Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-87233
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated
- Human, Mouse, Rat
- PPP2R3A
- This antibody was developed against Recombinant Protein corresponding to amino acids: EQRDPFAVQK DVENDGPEPS DWDRFAAEEY ETLVAEESAQ AQFQEGFEDY ETDEPASPSE FGNKSNKILS ASLPEKCGKL QSVDEE
- Unconjugated
- Rabbit
- PPP2R3, PR130, PR72
- protein phosphatase 2 regulatory subunit B''alpha
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml (also 25ul)
Sequence
EQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE
Specifications/Features
Available conjugates: Unconjugated