- LRRC67 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84047
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Rabbit
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- LRRC67
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: MVRLTLDLIA RNSNLKPRKE ETISQCLKKI THINFSDKNI DAIEDLSLCK NLSVLYLYDN CISQITNLNY ATN
- Unconjugated
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- protein phosphatase 1 regulatory subunit 42
- LRRC67, TLLR, TLRR, dtr
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MVRLTLDLIARNSNLKPRKEETISQCLKKITHINFSDKNIDAIEDLSLCKNLSVLYLYDNCISQITNLNYATN
Specifications/Features
Available conjugates: Unconjugated