- S100A8 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90314
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: LTELEKALNS IIDVYHKYSL IKGNFHAVYR DDLKKLLETE CPQYIRKKGA DVWFKELDIN TDGAVNFQEF LILVIKM
- Unconjugated
- Human
- S100A8
- 0.1 ml (also 25ul)
- 60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8, S100-A8
- S100 calcium binding protein A8
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cancer
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM
Specifications/Features
Available conjugates: Unconjugated