- S100A6 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89388
- 0.1 ml (also 25ul)
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- S100A6
- This antibody was developed against Recombinant Protein corresponding to amino acids: AIFHKYSGRE GDKHTLSKKE LKELIQKELT IGSKLQDAEI ARLMEDLDRN KDQEVNFQEY VTFLGALALI YNE
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- 2A9, 5B10, CABP, CACY, PRA, S10A6
- Human, Mouse, Rat
- Rabbit
- S100 calcium binding protein A6
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
AIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNE
Specifications/Features
Available conjugates: Unconjugated