- CISD2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84809
- This antibody was developed against Recombinant Protein corresponding to amino acids: PKKKQQKDSL INLKIQKENP KVVNEINIED LCLTKAAYCR CWRSKTFPAC DGSHNKHNEL TGDNVGPLIL KKKEV
- CISD2
- Rabbit
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human
- 0.1 ml
- ERIS, Miner1, NAF-1, WFS2, ZCD2
- CDGSH iron sulfur domain 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Immunogen affinity purified
- Primary Antibodies
- Neuroscience, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Polyclonal
Sequence
PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
Specifications/Features
Available conjugates: Unconjugated