- JM4 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-87886
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml (also 25ul)
- JM4
- Unconjugated
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Human, Rat
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: MSEVRLPPLR ALDDFVLGSA RLAAPDPCDP QRWCHRVINN
- PRA1 domain family member 2
- JM4, Yip6a
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINN
Specifications/Features
Available conjugates: Unconjugated