- NUDCD2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84118
- NUDCD2
- 0.1 ml (also 25ul)
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Human
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: PFEERSGVVP CGTPWGQWYQ TLEEVFIEVQ VPPGTRAQDI QCGLQSRHVA LSV
- NudC domain containing 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Core ESC Like Genes, Stem Cell Markers
- NudCL2
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSV
Specifications/Features
Available conjugates: Unconjugated