- hHpr1-p84-Thoc1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89669
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: VFCGRIQLFL ARLFPLSEKS GLNLQSQFNL ENVTVFNTNE QESTLGQKHT EDREEGMDVE EGEMGDEEAP TTCSIPIDYN LYRKFWS
- Human
- DFNA86, HPR1, P84, P84N5
- Unconjugated
- hHpr1-p84-Thoc1
- Rabbit
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- THO complex subunit 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Cancer, Cellular Markers, DNA Repair, DNA replication Transcription Translation and Splicing, Nuclear Envelope Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
VFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWS
Specifications/Features
Available conjugates: Unconjugated