- Treacher Collins syndrome protein Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86908
- Treacher Collins syndrome protein
- 0.1 ml (also 25ul)
- Rabbit
- MFD1, TCS, TCS1, treacle
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: KSLGNILQAK PTSSPAKGPP QKAGPVAVQV KAEKPMDNSE SSEESSDSAD SEEAPAAMTA AQAKPALKIP QTKACPKKTN TTAS
- Human
- Unconjugated
- treacle ribosome biogenesis factor 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Core ESC Like Genes, Stem Cell Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
KSLGNILQAKPTSSPAKGPPQKAGPVAVQVKAEKPMDNSESSEESSDSADSEEAPAAMTAAQAKPALKIPQTKACPKKTNTTAS
Specifications/Features
Available conjugates: Unconjugated