- XTP12 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90533
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Human
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: KQFLHVLSRK DKTGIVVNNP NQSVFLFIDR QHLQTPKNKA TIFKLCSICL YLPQEQLTHW AVGTIEDHLR PYMPE
- Nbla00237, XTP12, dJ30M3.2
- 0.1 ml (also 25ul)
- XTP12
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- chromosome 6 open reading frame 62
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
KQFLHVLSRKDKTGIVVNNPNQSVFLFIDRQHLQTPKNKATIFKLCSICLYLPQEQLTHWAVGTIEDHLRPYMPE
Specifications/Features
Available conjugates: Unconjugated