- HMGB4 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-93780
- 0.1 ml (also 25ul)
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Human
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: PPSSFLLFCQ DHYAQLKREN PNWSVVQVAK ATGKMWSTAT DLEKHPYEQR VALLRAKYFE ELELYRKQCN ARKKYRMS
- high mobility group box 4
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Rabbit
- HMGB4
- dJ1007G16.5
- PBS (pH 7.2) and 40% Glycerol
Sequence
PPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMS
Specifications/Features
Available conjugates: Unconjugated