- QN1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-91158
- 0.1 ml (also 25ul)
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: VLLDSLDSVA EVNLDEQDKI TPKPRCLPEM TENEMTGTGV SYGQSSSDVE ALHQAYCHIA HSLGDEDKQK IESNTVEDIK SSVKGHPQEN
- Human
- QN1
- Rabbit
- Immunohistochemistry, Immunohistochemistry-Paraffin
- C6orf84, KIAA1009, QN1
- centrosomal protein 162
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
VLLDSLDSVAEVNLDEQDKITPKPRCLPEMTENEMTGTGVSYGQSSSDVEALHQAYCHIAHSLGDEDKQKIESNTVEDIKSSVKGHPQEN
Specifications/Features
Available conjugates: Unconjugated