Rabbit Anti-Human CFHR1 Polyclonal Antibody-CTA-404 from Creative Biolabs | Biocompare.com

Be the first to write a review!

Supplier Page from
Creative Biolabs for
Rabbit Anti-Human CFHR1 Polyclonal Antibody-CTA-404

Creative Biolabs' Rabbit Anti-Human CFHR1 Polyclonal Antibody-CTA-404 is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunofluorescence, Immunohistochemistry, and Western Blot. The Rabbit Anti-Human CFHR1 Polyclonal Antibody-CTA-404 was generated using CFHR1 as the antigen and it reacts with Human.

Product Specs
ItemRabbit Anti-Human CFHR1 Polyclonal Antibody-CTA-404
CompanyCreative Biolabs
Price Supplier Page View Company Product Page
Catalog NumberCTA-404
Research AreaHemolytic Uremic Syndrome, Atypical 1 and Macular Degeneration, Age-Related, 1
Quantity100 µL
Purity≥95% as determined by SDS-PAGE
Antibody TypePrimary Antibody
FormatLiquid
ApplicationsWB, IF, IHC
ReactivityHuman (Hu)
NCBI Gene AliasesFHR1, CFHR1P, CFHL, H36-1, H36-2, H36, HFL1, HFL2, CFHL1, CFHL1P, FHR-1
NCBI Full Gene Namecomplement factor H related 1
HostRabbit
TargetCFHR1
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: TGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCA
IsotypeIgG
ClonalityPolyclonal

Add to Compare List

Creative Biolabs

Creative Biolabs

Phone: 1-631-357-2254
1-631-416-1478

Email: info@creative-biolabs.com

Company Profile

Website: https://www.creativebiolabs.net/

Website: https://www.creative-biolabs.com/

Be the First to Write a Review!