LGR8 (RXFP2) Rabbit Polyclonal Antibody TA358545 from OriGene Technologies | Biocompare.com

Supplier Images

LGR8 (RXFP2) Rabbit Polyclonal Antibody

Rabbit Anti-RXFP2 antibody
Catalog Number: ARP63832
Formalin Fixed Paraffin Embedded Tissue: Human Lung
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

Be the first to write a review!

Supplier Page from
OriGene Technologies for
LGR8 (RXFP2) Rabbit Polyclonal Antibody

OriGene Technologies' LGR8 (RXFP2) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry. The LGR8 (RXFP2) Rabbit Polyclonal Antibody was generated using RXFP2 as the antigen and it reacts with Homo Sapiens, and Human.

Description

RXFP2 Antibody

Product Specs
ItemLGR8 (RXFP2) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA358545
Quantity100 µl
ApplicationsIHC
ReactivityHuman
TargetLGR8
HostRabbit
Antibody TypePrimary Antibodies
NCBI Full Gene Namerelaxin family peptide receptor 2
NCBI Gene AliasesGREAT, LGR8.1, LGR8, INSL3R, GPR106, RXFPR2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
Conjugate/TagUnconjugated
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence TEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSVILICIWMAGFLIAVI
Concentrationlot specific
PurityAffinity Purified

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!