ACAT2 (acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase)) Antibody (against the middle region of ACAT2) (100ug) from Aviva Systems Biology

ACAT2 (acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase)) Antibody (against the middle region of ACAT2) (100ug) from Aviva Systems Biology

Product ACAT2 (acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase)) Antibody (against the middle region of ACAT2) (100ug)
Company Aviva Systems Biology
Price
More Information View Company Product Page
Accession Number NP_005882 NM_005891
Disease sssDisease Product Link Publications Publications Link s ssssMental Retardation sMental Retardation Antibodies s1 sACAT2 AND Mental Retardation s ssFatty Liver sFatty Liver Antibodies s15 sACAT2 AND Fatty Liver s ssLiver Neoplasms sLiver Neoplasms Antibodies s6 sACAT2 AND Liver Neoplasms s ssDrug-Induced Liver Injury sDrug-Induced Liver Injury Antibodies s1 sACAT2 AND Drug-Induced Liver Injury s ssAdenoma, Liver Cell sAdenoma, Liver Cell Antibodies s0 sACAT2 AND Adenoma, Liver Cell s ssLiver Neoplasms, Experimental sLiver Neoplasms, Experimental Antibodies s1 sACAT2 AND Liver Neoplasms, Experimental s ssBlood Coagulation Disorders sBlood Coagulation Disorders Antibodies s0 sACAT2 AND Blood Coagulation Disorders s ssHepatomegaly sHepatomegaly Antibodies s0 sACAT2 AND Hepatomegaly s ssInflammation sInflammation Antibodies s0 sACAT2 AND Inflammation s ssCarcinoma, Hepatocellular sCarcinoma, Hepatocellular Antibodies s6 sACAT2 AND Carcinoma, Hepatocellular s s
Gene Name acetyl-CoA acetyltransferase 2
Molecular Weight 44kDa
Tissue sssTissue Product Link Publications Link s ssssIntestine sIntestine Antibodies sACAT2 AND Intestine s ssLiver sLiver Antibodies sACAT2 AND Liver s ssPharynx sPharynx Antibodies sACAT2 AND Pharynx s ssSalivary gland sSalivary gland Antibodies sACAT2 AND Salivary gland s ssTonsils sTonsils Antibodies sACAT2 AND Tonsils s ssNerve sNerve Antibodies sACAT2 AND Nerve s ssMale system sMale system Antibodies sACAT2 AND Male system s ssSkin sSkin Antibodies sACAT2 AND Skin s s
Immunogen Immunogen: Synthetic peptide directed towards the middle region of human ACAT2
Target/Molecule Descriptor Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.
Target ACAT2
Catalog Number ARP32791_T100
Quantity 100ug
Species Human
Reactivity Human, Mouse, Rat, Bovine
Conjugate/Tag/Label Unconjugated
Applications WB, IHC
Host Rabbit
Type Polyclonal
Isotype IgG
Form Lyophilized powder
Original Item Name ACAT2 (acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase)) Antibody

Description

Aviva Systems Biology is the original manufacturer of this ACAT2 antibody. ACAT2 is a Rabbit Polyclonal Antibody reacted with Human and tested in Western Blot and immunohistochemistry. ACAT2,acetyl-CoA acetyltransferase 2,ACAT2,acetyl-CoA acetyltransferas This is a rabbit polyclonal antibody against ACAT2. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com). This is a rabbit polyclonal antibody against ACAT2. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).

References

Sakashita,N.,et al., (2003) Lab.Invest.83(11),1569-1581

Specifications/Features

Human:100%; Sumatran orangutan:100%; Human:100%; Short-tailed gray opossum:83%; Rat:78%; Bovine:78%; Mouse:78%

Sequence

VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMS

Contact Information

11025 Roselle Street, Suite 100,
San Diego, CA 92121

Customer Service:
858-552-6979
888-880-0001 (Toll Free)


Fax Number:
858-552-6975


Note: Biocompare disclaims any information on this site. Price information is approximate list price and actual prices may vary.

Selected Products

No selected items.
advertisement
Advertisement (image not found)

Loading

Loading