Human Exendin-4 Peptide from Abbiotec

Product Human Exendin-4 Peptide
Company Abbiotec
Price
More Information View Company Product Page
Catalog Number 350171
Quantity 1 mg
Species Human
Conjugate/Tag Unconjugated
Accession Number P26349
Molecule Name Exendin-4 Peptide
Name Synonyms Exendin-4, exenatide
Source/Expression System Synthetic
Form/Grade/Purity Format: Each vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt.
Purity: > 95% by HPLC
Solubility: Distilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile.

Description

Exedins are secreted by lizard venom gland. They have a VIP/secretin-like biological activity when binding to the exendin receptor. Exedin-4 (named Byetta, Amylin/Eli Lilly) is used for the treatment of type 2 diabetes by enhancing insulin secretion.
Protein Family: Hormones
Pathway & Disease: Metabolic Disorders
MW: 4186.03 g/mol
Sequence: H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile
-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 or H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Composition: C184H282N50O60S1

Abbiotec Contact Information

Abbiotec
7955 Dunbrook Road, Suite B
San Diego, CA 92126 USA

Customer Service: 1-800-854-7453

Fax Number: 1-858-586-6252

Note: Biocompare disclaims any information on this site. Price information is approximate list price and actual prices may vary.

advertisement

You do not have JavaScript enabled or are using an older version of Adobe Flash. You can update your version of Adobe Flash here.

Loading

Loading