Human Exendin-4 Peptide from Abbiotec

Human Exendin-4 Peptide from Abbiotec

Product Human Exendin-4 Peptide
Company Abbiotec
Price
More Information View Company Product Page
Conjugate/Tag/Label Unconjugated
Form Format: Each vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt.
Purity: > 95% by HPLC
Solubility: Distilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile.
Target/Molecule Synonym Exendin-4, exenatide
Accession Number P26349
Catalog Number 350171
Molecule Name Exendin-4 Peptide
Original Item Name Exendin-4 Peptide
Quantity 1 mg
Source/Expression System Synthetic
Species Human

Description

Exedins are secreted by lizard venom gland. They have a VIP/secretin-like biological activity when binding to the exendin receptor. Exedin-4 (named Byetta, Amylin/Eli Lilly) is used for the treatment of type 2 diabetes by enhancing insulin secretion.
Protein Family: Hormones
Pathway & Disease: Metabolic Disorders
MW: 4186.03 g/mol
Sequence: H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile
-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 or H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Composition: C184H282N50O60S1

Contact Information

7985 Dunbrook Road, Suite A
San Diego, CA 92126
USA

Customer Service: 1-800-854-7453 or 1-858-586-0500

Fax Number: 1-858-586-6252

Note: Biocompare disclaims any information on this site. Price information is approximate list price and actual prices may vary.

Selected Products

No selected items.
advertisement
Advertisement (image not found)

Loading

Loading