Bio-Rad (Formerly AbD Serotec)'s HUMAN ANTI USTEKINUMAB is a Human monoclonal antibody. This antibody has been shown to work in applications such as: EIA, Immunoassay, and ELISA.
Description
A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL phage display library, expressed in E. coli. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK)