- cGAS Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86761
- 0.1 ml (also 25ul)
- Rabbit
- C6orf150, MB21D1, h-cGAS
- Human
- Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Unconjugated
- cGAS
- This antibody was developed against Recombinant Protein corresponding to amino acids: RKQLRLKPFY LVPKHAKEGN GFQEETWRLS FSHIEKEILN NHGKSKTCCE NKEEKCCRKD CLKLMKYLLE QLKERF
- PBS (pH 7.2) and 40% Glycerol
- cyclic GMP-AMP synthase
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cell Biology
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERF
Specifications/Features
Available conjugates: Unconjugated