- NDUFB3 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88929
- Rabbit
- 0.1 ml (also 25ul)
- NDUFB3
- Unconjugated
- B12, CI-B12, MC1DN25
- PBS (pH 7.2) and 40% Glycerol
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: MAHEHGHEHG HHKMELPDYR QWKIEGTPLE TIQKKLAAKG LRDPWGRNEA WRYMGGFAKS VSF
- NADH:ubiquinone oxidoreductase subunit B3
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSF
Specifications/Features
Available conjugates: Unconjugated