- 14-3-3 beta/alpha Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-80611
- Human, Mouse, Rat
- Rabbit
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: ICNDVLELLD KYLIPNATQP ESKVFYLKMK GDYFRYLSEV ASGDNKQTTV SNSQQAYQEA FEISKKE
- 14-3-3 beta/alpha
- GW128, KCIP-1, HS1, YWHAA, HEL-S-1
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Alzheimers Research, Cancer, Cell Biology, Cell Cycle and Replication, Growth and Development, Neuronal Cell Markers, Neuroscience, Phospho Specific, Protein Kinase, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKE
Specifications/Features
Available conjugates: Unconjugated