- SIRT4 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-80746
- This antibody was developed against Recombinant Protein corresponding to amino acids: PCSKASIGLF VPASPPLDPE KVKELQRFIT LSKRLLVMTG AGISTESGIP DYRSEKVGLY ARTDRRPIQH GDFVR
- 0.1 ml (also 25ul)
- Unconjugated
- Human
- PBS (pH 7.2) and 40% Glycerol
- SIRT4
- Rabbit
- SIR2L4
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- sirtuin 4
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- DNA Repair, Epigenetics, Homologous Recombination
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVR
Specifications/Features
Available conjugates: Unconjugated