- Testican 2/SPOCK2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92442
- Unconjugated
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Testican 2/SPOCK2
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: EQQACLSSKQ LAVRCEGPCP CPTEQAATST ADGKPETCTG QDLADLGDRL RDWFQLLHEN SKQNGSASSV AGPASGLDKS LGASCKDS
- testican-2
- Human
- SPARC (osteonectin), cwcv and kazal like domains proteoglycan 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
EQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDS
Specifications/Features
Available conjugates: Unconjugated