- PNPO Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-87302
- Human
- 0.1 ml (also 25ul)
- Rabbit
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: MTCWLRGVTA TFGRPAEWPG YLSHLCGRSA AMDLGPMRKS YRGDREAFEE THLTSLDPVK QFAAWFEEAV QCPDIGEANA MCLATCTR
- PBS (pH 7.2) and 40% Glycerol
- HEL-S-302, PDXPO
- PNPO
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated
- pyridoxamine 5'-phosphate oxidase
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Cancer, metabolism
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLATCTR
Specifications/Features
Available conjugates: Unconjugated