- SETD6 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-93955
- Human
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: LLQGTGVPEA VEKDLANIRS EYQSIVLPFM EAHPDLFSLR VRSLELYHQL VALVMAYSFQ EPLEEEEDEK EPN
- SETD6
- SET domain containing 6, protein lysine methyltransferase
- Western Blot (WB)
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Immunogen affinity purified
- Unconjugated
Sequence
LLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPN
Specifications/Features
Available conjugates: Unconjugated